PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100182950031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 219aa    MW: 23589.9 Da    PI: 9.9805
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100182950031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof60.24.2e-1941732860
                        zf-Dof 28 qPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                                   PryfCkaCrryWt+GG+lr vP+Ggg+rk k+
  Ote100182950031|100182950031 41 CPRYFCKACRRYWTQGGTLRTVPIGGGCRKPKR 73
                                  6*****************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088415.8731973IPR003851Zinc finger, Dof-type
PfamPF027015.1E-154173IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-114273IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MDGARNEEDL VLQQDLQHRP RPPENHAGAH NHHPPAPPPS CPRYFCKACR RYWTQGGTLR  60
TVPIGGGCRK PKRPRILTPS SSSSSFPSNS LIPRARGLSP AAARSQNLYS GEPSSRPVXX  120
XXXXXXXXXX XGPLYPAPAP PQQNLPPMTQ FFQPPQQSLA PAGRFGSWTQ SVLNAGATSS  180
SAEATPGLWN GGGRDGSSDQ GGPSFNPNQW PDSNPGFDH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2473822